Structure of PDB 5yiv Chain D Binding Site BS01

Receptor Information
>5yiv Chain D (length=45) Species: 565050 (Caulobacter vibrioides NA1000) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSWTDERVSTLKKLWLDGLSASQIAKQLGGVTRNAVIGKVHRLGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yiv Structural insights into the unique mechanism of transcription activation by Caulobacter crescentus GcrA.
Resolution2.914 Å
Binding residue
(original residue number in PDB)		S20 A21 R33 I37 H41
Binding residue
(residue number reindexed from 1)		S20 A21 R33 I37 H41
Enzymatic activity
Enzyme Commision number ?
External links