Structure of PDB 5ye4 Chain D Binding Site BS01

Receptor Information
>5ye4 Chain D (length=212) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIQMTQSPSSLSASLGDKVTITCRASQDINNYIAWFQHKPGKGPRLLIYY
TSTLQPGIPSRFSGSGSGRDYSFSIRNLEPEDIATYYCLQYDNLRTFGGG
TKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKID
GSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTS
TSPIVKSFNRNE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ye4 JQ1 affects BRD2-dependent and independent transcription regulation without disrupting H4-hyperacetylated chromatin states.
Resolution1.799 Å
Binding residue
(original residue number in PDB)		Y32 Y49 Q55 P56 L89 Y91 D92 R95
Binding residue
(residue number reindexed from 1)		Y32 Y49 Q55 P56 L89 Y91 D92 R95
External links