Structure of PDB 5yc1 Chain D Binding Site BS01

Receptor Information
>5yc1 Chain D (length=161) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRRELEELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGY
KLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQS
DPGLAKPQHVTETFHPDPNWKNFQKPSLGFGYPKFISHQDIRKRNYVRDD
AVFIRAAVELP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yc1 Molecular basis for unique specificity of human TRAF4 for platelets GPIb beta and GPVI
Resolution2.506 Å
Binding residue
(original residue number in PDB)		G356 Y366 F408 W414 G433 F434 G435 Y436
Binding residue
(residue number reindexed from 1)		G62 Y72 F114 W120 G129 F130 G131 Y132
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0007250 activation of NF-kappaB-inducing kinase activity
GO:0046330 positive regulation of JNK cascade

View graph for
Biological Process
External links
PDB RCSB:5yc1, PDBe:5yc1, PDBj:5yc1
PDBsum5yc1
PubMed29073066
UniProtQ9BUZ4|TRAF4_HUMAN TNF receptor-associated factor 4 (Gene Name=TRAF4)

[Back to BioLiP]