Structure of PDB 5xyn Chain D Binding Site BS01

Receptor Information

>5xyn Chain D (length=205) Species: 559292 (Saccharomyces cerevisiae S288C)

DVIEYSKLFAKLVNTDTKLDDTIASFLYYMFPRELFIRAISLLESSDMFI
YILDTSLIDVLVDEFYKNSLLEYRLIVKDTNDGAPPILVDIAHWFCSCEE
FCKYFHEALEKTDEKEELHDVLINEVDDHLQFSDDRFAQLDPHSLSKQWY
FKFDKVCCSHLLAFSILLRSSINVLKFFTVNSNKVFVIAIDNIDEWLNLH
INIVE

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 5xyn Chain D Residue 301

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5xyn Structural basis for the functional role of the Shu complex in homologous recombination.
• Resolution: 3.3 Å
• Binding residue (original residue number in PDB): C114 C116 C176 H178
• Binding residue (residue number reindexed from 1): C96 C98 C158 H160
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003674 molecular_function

Biological Process

• GO:0000725 recombinational repair
• GO:0000730 DNA recombinase assembly
• GO:0006281 DNA repair
• GO:0006310 DNA recombination
• GO:0042275 error-free postreplication DNA repair
• GO:0043007 maintenance of rDNA
• GO:1903112 positive regulation of single-strand break repair via homologous recombination

Cellular Component

• GO:0005634 nucleus
• GO:0035861 site of double-strand break
• GO:0097196 Shu complex

External links

• PDB: RCSB:5xyn, PDBe:5xyn, PDBj:5xyn
• PDBsum: 5xyn
• PubMed: 29069504
• UniProt: P38957|SHU2_YEAST Suppressor of hydroxyurea sensitivity protein 2 (Gene Name=SHU2)