Structure of PDB 5xov Chain D Binding Site BS01

Receptor Information
>5xov Chain D (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFG
CDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAA
HVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRW
Ligand information
>5xov Chain F (length=10) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RYPLTFGWCF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xov Conserved V delta 1 Binding Geometry in a Setting of Locus-Disparate pHLA Recognition by delta / alpha beta T Cell Receptors (TCRs): Insight into Recognition of HIV Peptides by TCRs.
Resolution2.684 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 V67 H70 N77 Y84 M97 F99 H114 Y116 Y123 T143 K146 W147 Q156 Y159 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 K66 V67 H70 N77 Y84 M97 F99 H114 Y116 Y123 T143 K146 W147 Q156 Y159 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5xov, PDBe:5xov, PDBj:5xov
PDBsum5xov
PubMed28615212
UniProtP04439|HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain (Gene Name=HLA-A)

[Back to BioLiP]