Structure of PDB 5xm0 Chain D Binding Site BS01

Receptor Information
>5xm0 Chain D (length=94) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRL
AHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Ligand information
>5xm0 Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xm0 Histone H3.3 sub-variant H3mm7 is required for normal skeletal muscle regeneration.
Resolution2.874 Å
Binding residue
(original residue number in PDB)		R31 R33 I54 S55 S56 R86 S87 T88
Binding residue
(residue number reindexed from 1)		R1 R3 I24 S25 S26 R56 S57 T58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5xm0, PDBe:5xm0, PDBj:5xm0
PDBsum5xm0
PubMed29643389
UniProtQ9D2U9|H2B3A_MOUSE H2B.U histone 2 (Gene Name=H2bu2)

[Back to BioLiP]