Structure of PDB 5xcr Chain D Binding Site BS01

Receptor Information

>5xcr Chain D (length=161) Species: 10090 (Mus musculus)

QIQLVQSGPEVQKPGETVRISCKASGYTFTTAGMQWVQKMPGKSLKWIGW
INTRSGVPKYAEDFKGRFAFSLETSASIAYLHINNLKNEDTATYFCAREG
PGFVYWGQGTLVTVSEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKCQS
KRQPILDAIEA

Ligand information

>5xcr Chain F (length=6) Species: 9606 (Homo sapiens)

GYPGQV

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5xcr Fv-clasp: An Artificially Designed Small Antibody Fragment with Improved Production Compatibility, Stability, and Crystallizability
• Resolution: 1.75 Å
• Binding residue (original residue number in PDB): T30 A32 G33 W50 N52 T52A E95 G96 P97
• Binding residue (residue number reindexed from 1): T30 A32 G33 W50 N52 T53 E99 G100 P101

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 06:07:45 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5xcr', asym_id = 'D', bs = 'BS01', title = 'Fv-clasp: An Artificially Designed Small Antibod...n Compatibility, Stability, and Crystallizability'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5xcr', asym_id='D', bs='BS01', title='Fv-clasp: An Artificially Designed Small Antibod...n Compatibility, Stability, and Crystallizability')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004674,0007165,0051262', uniprot = '', pdbid = '5xcr', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004674,0007165,0051262', uniprot='', pdbid='5xcr', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>