Structure of PDB 5x8t Chain D Binding Site BS01

Receptor Information

>5x8t Chain D (length=212) Species: 3562 (Spinacia oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VDAGIGVMGTKLGMMSFFEEDGTVVPVTVIGFKEGNIVTQVKTESTDGYN
AVQVGYERLRDRKLTMPERGHLNKAGVIPMRHLQEFRLVSVDDFTPSQKL
LFEELFKEGDMVDISGTTIGKGFQGGIKRHNFKRGLMTHGSKSHRALGSI
GAGTTPGHVYKGKKMPGRMGGTKTKIRKLKIMKIDTDLRVVMIKGAVPGK
PGNLLRLAPAKI

Ligand information

>5x8t Chain W (length=102) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaggucacggcgagacgagccguuuaucauuacgauaggugucaagugga
agugcagugauguaugcagcugaggcauccuaacagacccacagacuuga
ac

..<<<<<<<<<.......>>>>>............<<<<<<<<.<<<...
.<<<<<....>>>>>...>>>..>>>>>.>>>...>>>>...........
..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5x8t Unique localization of the plastid-specific ribosomal proteins in the chloroplast ribosome small subunit provides mechanistic insights into the chloroplastic translation
Resolution	3.3 Å
Binding residue (original residue number in PDB)	K118 E119 R143 L144 R145 K148 T150 M151 R166 I204 G205 G207 F208 R253 K285 P286
Binding residue (residue number reindexed from 1)	K33 E34 R58 L59 R60 K63 T65 M66 R81 I119 G120 G122 F123 R168 K200 P201

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5x8t, PDBe:5x8t, PDBj:5x8t
PDBsum	5x8t
PubMed	28582576
UniProt	P82191\|RK3_SPIOL Large ribosomal subunit protein uL3c (Gene Name=RPL3)

[Back to BioLiP]