Structure of PDB 5wzz Chain D Binding Site BS01

Receptor Information
>5wzz Chain D (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLD
AVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLV
LEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRS
IHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wzz The SIAH E3 ubiquitin ligases promote Wnt/ beta-catenin signaling through mediating Wnt-induced Axin degradation
Resolution2.103 Å
Binding residue
(original residue number in PDB)
L158 D162 I163 V164 F165 L166 A167 T168 D177 W178 V179 M180
Binding residue
(residue number reindexed from 1)
L66 D70 I71 V72 F73 L74 A75 T76 D85 W86 V87 M88
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007275 multicellular organism development
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5wzz, PDBe:5wzz, PDBj:5wzz
PDBsum5wzz
PubMed28546513
UniProtQ8IUQ4|SIAH1_HUMAN E3 ubiquitin-protein ligase SIAH1 (Gene Name=SIAH1)

[Back to BioLiP]