Structure of PDB 5we0 Chain D Binding Site BS01

Receptor Information
>5we0 Chain D (length=216) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNEKIRSQSVLNTLETFFIKENHYDMQREESSIVNACLRYLGYSKSMCHE
KMPIFMDIAFIEYCFNLSLSQQILWEYSLISNALERLENIELERQNCMRE
LNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINFTKFLQDWGSH
NEKEMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSVLSRYIQCTKLQL
EVFCDYDFKQREIVKM
Ligand information
>5we0 Chain E (length=29) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CEMCRLGLPHGSFFELLRDWKKIEEFRNK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5we0 Structural Basis for Shelterin Bridge Assembly.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		F18 Y24 R28 N35 L38 L41 G42 Y43 K45 M47 C48 H49 M52 F60 Y63 C64 Q88 I89 L90 L95 N98 R102
Binding residue
(residue number reindexed from 1)		F18 Y24 R28 N35 L38 L41 G42 Y43 K45 M47 C48 H49 M52 F60 Y63 C64 Q72 I73 L74 L79 N82 R86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0000723 telomere maintenance
GO:0016233 telomere capping
GO:0032200 telomere organization
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0070187 shelterin complex
GO:0140445 chromosome, telomeric repeat region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5we0, PDBe:5we0, PDBj:5we0
PDBsum5we0
PubMed29149597
UniProtO13852|POZ1_SCHPO Protection of telomeres protein poz1 (Gene Name=poz1)

[Back to BioLiP]