Structure of PDB 5w1w Chain D Binding Site BS01

Receptor Information
>5w1w Chain D (length=201) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQDPGEGPVLLIALYKA
GELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGQPLGGSNYKLT
FGKGTLLTVNPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKD
SDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
S
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5w1w A conserved energetic footprint underpins recognition of human leukocyte antigen-E by two distinct alpha beta T cell receptors.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Q107 G110 G111 S112 N113 Y114
Binding residue
(residue number reindexed from 1)		Q90 G93 G94 S95 N96 Y97
External links