Structure of PDB 5vwk Chain D Binding Site BS01

Receptor Information
>5vwk Chain D (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVS
EEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRE
R
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vwk Structural basis for the differential interaction of Scribble PDZ domains with the guanine nucleotide exchange factor beta-PIX.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		G737 L738 I740 S741 I742 A743 G747 S748 T749 S761 H793 V797
Binding residue
(residue number reindexed from 1)		G23 L24 I26 S27 I28 A29 G33 S34 T35 S47 H79 V83
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5vwk, PDBe:5vwk, PDBj:5vwk
PDBsum5vwk
PubMed29061852
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]