Structure of PDB 5vnb Chain D Binding Site BS01

Receptor Information
>5vnb Chain D (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFK
LHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLK
LFQSDTNAKTVVSEFYDEMIFQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vnb GAS41 Recognizes Diacetylated Histone H3 through a Bivalent Binding Mode.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		H71 Y74 G92 W93 G94 E95 F96 E97 F121
Binding residue
(residue number reindexed from 1)		H52 Y55 G73 W74 G75 E76 F77 E78 F102
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5vnb, PDBe:5vnb, PDBj:5vnb
PDBsum5vnb
PubMed30071723
UniProtO95619|YETS4_HUMAN YEATS domain-containing protein 4 (Gene Name=YEATS4)

[Back to BioLiP]