Structure of PDB 5vl9 Chain D Binding Site BS01

Receptor Information

>5vl9 Chain D (length=189) Species: 1334193 ([Enterobacter] lignolyticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LNREERRETIMQAAMRVALDQGFTGMTVRNIATAAGVAAGQVHHHFTSSG
ELKSQAFIRVIREMMDLQRLSRTAGWREQLFSALGSEDGRLEPYIRLWRQ
AQLLADSDPEIKSAYLLTMNLWHDEAVRIIRAGHAAGEFTLRDSAENIAW
RLISLVCGLDGIYVLGMPEVDDAAFTRHLQHVIQLELFS

Ligand information

>5vl9 Chain G (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tatgtccaactttc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5vl9 Jungle Express is a versatile repressor system for tight transcriptional control.
Resolution	2.16 Å
Binding residue (original residue number in PDB)	T30 V31 H46 S51 S52
Binding residue (residue number reindexed from 1)	T27 V28 H43 S48 S49

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0009889	regulation of biosynthetic process
GO:0080090	regulation of primary metabolic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5vl9, PDBe:5vl9, PDBj:5vl9
PDBsum	5vl9
PubMed	30190458
UniProt	E3G817

[Back to BioLiP]