Structure of PDB 5vau Chain D Binding Site BS01

Receptor Information
>5vau Chain D (length=137) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNREIVMKYIHYKLSQRGYEWDASEVVHLTLRQAGDDFSRRYRRDFAEMS
SQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYG
Ligand information
>5vau Chain H (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TMENLSRRLKVTGDLFDIMS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vau Bcl-2 complex with Beclin 1 BH3 domain
Resolution1.754 Å
Binding residue
(original residue number in PDB)
D103 F104 R107 Y108 F112 M115 V133 E136 L137 D140 N143 G145 R146 F153 Y202
Binding residue
(residue number reindexed from 1)
D37 F38 R41 Y42 F46 M49 V67 E70 L71 D74 N77 G79 R80 F87 Y136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5vau, PDBe:5vau, PDBj:5vau
PDBsum5vau
PubMed
UniProtP10415|BCL2_HUMAN Apoptosis regulator Bcl-2 (Gene Name=BCL2)

[Back to BioLiP]