Structure of PDB 5vao Chain D Binding Site BS01

Receptor Information
>5vao Chain D (length=129) Species: 1570291 (Ebola virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPKITLLTLIKTAEHWARQDIRTIEDSKLRALLTLCAVMTRKFSKSQLSL
LCETHLRREGLGQDQAEPVLEVYQRLHSDKGGSFEAALWQQWDRQSLIMF
ITAFLNIALQLPCESSAVVVSGLRTLVPQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vao Ebola virus VP30 and nucleoprotein interactions modulate viral RNA synthesis.
Resolution2.56 Å
Binding residue
(original residue number in PDB)		K218 G219
Binding residue
(residue number reindexed from 1)		K80 G81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:5vao, PDBe:5vao, PDBj:5vao
PDBsum5vao
PubMed28593988
UniProtQ77DJ5|VP30_EBOZ5 Transcriptional activator VP30 (Gene Name=VP30)

[Back to BioLiP]