Structure of PDB 5v6y Chain D Binding Site BS01

Receptor Information

>5v6y Chain D (length=547) Species: 9606,83333 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVA
ATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNG
KLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNL
QEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKN
KHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFK
GQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGA
VALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAA
SGRQTVDEALKDAQTNAAAEFTTACQEANYGALLRELCLTQFQVDMEAVG
ETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFR
SCPIVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAG
TESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCN

Ligand information

>5v6y Chain H (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NVAPRWLISPWGF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5v6y Probing the Mechanism of Receptor Activity-Modifying Protein Modulation of GPCR Ligand Selectivity through Rational Design of Potent Adrenomedullin and Calcitonin Gene-Related Peptide Antagonists.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	Y343 N369 D2070 G2071 W2072 Q2093 D2094 H2114 A2116 S2117 R2119 W2121 T2122 Y2124 N2128
Binding residue (residue number reindexed from 1)	Y340 N366 D489 G490 W491 Q512 D513 H533 A535 S536 R538 W540 T541 Y543 N547

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004930	G protein-coupled receptor activity
GO:0015026	coreceptor activity
GO:0015144	carbohydrate transmembrane transporter activity

	Biological Process
GO:0006886	intracellular protein transport
GO:0007186	G protein-coupled receptor signaling pathway
GO:0008277	regulation of G protein-coupled receptor signaling pathway
GO:0008643	carbohydrate transport
GO:0055085	transmembrane transport

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5v6y, PDBe:5v6y, PDBj:5v6y
PDBsum	5v6y
PubMed	29363552
UniProt	O60894\|RAMP1_HUMAN Receptor activity-modifying protein 1 (Gene Name=RAMP1); P0AEX9\|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE); Q16602\|CALRL_HUMAN Calcitonin gene-related peptide type 1 receptor (Gene Name=CALCRL)

[Back to BioLiP]