Structure of PDB 5v1d Chain D Binding Site BS01

Receptor Information
>5v1d Chain D (length=247) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RSLVIISTLDGRIAALDPENHGKKQWDLDVGSGSLVSSSLSKPEKMIIPS
LDGDLFQWDRDRESMETVPFTVESLLEDVVLVGGKSLTTYGLSAYSGKVR
YICSALGCRQWDILLLQRTQKTVRAVGPRSGNEKWNFSVGHFELRYIPSD
VEEQEAVMMDTVIKVSVADWKVMAFNKKGGHLEWEYQFSTPIASAWLVKD
GKVIPISLFDDTSIVEAARGATENSVYLGMYRGQLYLQSSVRISEKF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v1d The luminal domain of the ER stress sensor protein PERK binds misfolded proteins and thereby triggers PERK oligomerization
Resolution2.799 Å
Binding residue
(original residue number in PDB)
M153 M172 A316 W318 V387 Y388 L389 G390
Binding residue
(residue number reindexed from 1)
M46 M65 A168 W170 V226 Y227 L228 G229
Enzymatic activity
Enzyme Commision number ?
External links