Structure of PDB 5ujt Chain D Binding Site BS01

Receptor Information

>5ujt Chain D (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EDIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPL
FRRFRRFDPQFALTNIAVLKHNLNCVIKRSNSTAATNEVPEVTVFSKSPV
TLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFK
ISYLTFLPSDDEIYDCKVEHWGLDEPLLKHW

Ligand information

>5ujt Chain F (length=14) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VEELYLVAGEEGCG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5ujt C-terminal modification of the insulin B:11-23 peptide creates superagonists in mouse and human type 1 diabetes.
Resolution	1.94 Å
Binding residue (original residue number in PDB)	R52 R53 F58 N62 V65 H68 N69 C72 R76
Binding residue (residue number reindexed from 1)	R55 R56 F61 N65 V68 H71 N72 C75 R79

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5ujt, PDBe:5ujt, PDBj:5ujt
PDBsum	5ujt
PubMed	29255035
UniProt	Q5Y7C3

[Back to BioLiP]