Structure of PDB 5u01 Chain D Binding Site BS01

Receptor Information
>5u01 Chain D (length=273) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTG
PGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGI
QCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDP
AGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDK
VQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRV
SMQLRRPSDRELSEPMEFQYLPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5u01 DNA-binding affinity and transcriptional activity of the RelA homodimer of nuclear factor kappa B are not correlated.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y36 C38 E39 K122 K123 R187 Q220 K221 R246 Q247
Binding residue
(residue number reindexed from 1)		Y18 C20 E21 K104 K105 R169 Q202 K203 R228 Q229
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5u01, PDBe:5u01, PDBj:5u01
PDBsum5u01
PubMed28935669
UniProtQ04207|TF65_MOUSE Transcription factor p65 (Gene Name=Rela)

[Back to BioLiP]