Structure of PDB 5tyi Chain D Binding Site BS01

Receptor Information
>5tyi Chain D (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHL
QKVKHYLILPSEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRH
CC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tyi Discovery, Development, and Cellular Delivery of Potent and Selective Bicyclic Peptide Inhibitors of Grb7 Cancer Target.
Resolution2.15 Å
Binding residue
(original residue number in PDB)
R438 S460 R462 N463 V468 K478 H479 Y480 L481 M495 D497
Binding residue
(residue number reindexed from 1)
R14 S36 R38 N39 V44 K54 H55 Y56 L57 M70 D72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5tyi, PDBe:5tyi, PDBj:5tyi
PDBsum5tyi
PubMed29083893
UniProtQ14451|GRB7_HUMAN Growth factor receptor-bound protein 7 (Gene Name=GRB7)

[Back to BioLiP]