Structure of PDB 5tp1 Chain D Binding Site BS01

Receptor Information
>5tp1 Chain D (length=155) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LNVDPSLQIDIPDALSERDKVKFTVHTKTTLSTFQSPEFSVTRQHEDFVW
LHDTLTETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKM
KQELEAEYLAVFKKTVSTHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSV
RRKNT
Ligand information
>5tp1 Chain S (length=20) Species: 272561 (Chlamydia trachomatis D/UW-3/CX) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EPTVQFFKGKNGSADKVILV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tp1 Chlamydia interfere with an interaction between the mannose-6-phosphate receptor and sorting nexins to counteract host restriction.
Resolution2.31 Å
Binding residue
(original residue number in PDB)		I35 P36 D37 A38 L39 S40 M106 E129 Y132 L133 F136 K137 V140 E144
Binding residue
(residue number reindexed from 1)		I11 P12 D13 A14 L15 S16 M82 E105 Y108 L109 F112 K113 V116 E120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035091 phosphatidylinositol binding

View graph for
Molecular Function
External links
PDB RCSB:5tp1, PDBe:5tp1, PDBj:5tp1
PDBsum5tp1
PubMed28252385
UniProtQ9D8U8|SNX5_MOUSE Sorting nexin-5 (Gene Name=Snx5)

[Back to BioLiP]