Structure of PDB 5t1k Chain D Binding Site BS01

Receptor Information

>5t1k Chain D (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGV
IWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALT
YYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSGGTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKRVEPK

Ligand information

>5t1k Chain F (length=12) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CQFDFSTRRLKC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5t1k Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
Resolution	2.48 Å
Binding residue (original residue number in PDB)	Q39 P41 T90 A91 I92 Q111 L114 E154 P155 P173
Binding residue (residue number reindexed from 1)	Q39 P41 T90 A91 I92 Q111 L114 E149 P150 P168

External links

PDB	RCSB:5t1k, PDBe:5t1k, PDBj:5t1k
PDBsum	5t1k
PubMed	27834791

[Back to BioLiP]