Structure of PDB 5onw Chain D Binding Site BS01

Receptor Information
>5onw Chain D (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEAS
RLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>5onw Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atccatatccacctggtcctactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctggaatccagctgaacatgccttttgatgga
gcagtttccaaatacacttttggtagtaggaccaggtggatatggat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5onw Site-Specific Disulfide Crosslinked Nucleosomes with Enhanced Stability.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
R26 R27 T29 S52 S53 R83 S84 T85
Binding residue
(residue number reindexed from 1)
R1 R2 T4 S27 S28 R58 S59 T60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:5onw, PDBe:5onw, PDBj:5onw
PDBsum5onw
PubMed29113904
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]