Structure of PDB 5oki Chain D Binding Site BS01

Receptor Information
>5oki Chain D (length=131) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSVDIDASQWQKLTQSREKQTTVITPLGMMMLEIQGELELPKDFASLARR
DSPNEGRFSEQDGETLIRFGSLQIDGERATLFVGKKQRLLGKVTKLDVPM
GIMHFNSKDNKVELVDVMKYKVIFKDRPLPI
Ligand information
>5oki Chain E (length=26) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TVKIWVKYNEGFSNAVRKNVTWNNLW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5oki Structural Basis for the Recruitment of Ctf18-RFC to the Replisome.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		P2 Q36 G37 E38 L39 E40 F70 K87 Q88 F106 S108
Binding residue
(residue number reindexed from 1)		P1 Q35 G36 E37 L38 E39 F69 K86 Q87 F105 S107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006260 DNA replication
GO:0007064 mitotic sister chromatid cohesion
GO:0034398 telomere tethering at nuclear periphery
GO:0035753 maintenance of DNA trinucleotide repeats
Cellular Component
GO:0005634 nucleus
GO:0031390 Ctf18 RFC-like complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5oki, PDBe:5oki, PDBj:5oki
PDBsum5oki
PubMed29225079
UniProtP38877|CTF8_YEAST Chromosome transmission fidelity protein 8 (Gene Name=CTF8)

[Back to BioLiP]