Structure of PDB 5nx3 Chain D Binding Site BS01

Receptor Information
>5nx3 Chain D (length=42) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALFFRWYFDVTEGKCAPFVYGGCGGNRNNFDTEEYCMAVCGS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nx3 A potent, proteolysis-resistant inhibitor of kallikrein-related peptidase 6 (KLK6) for cancer therapy, developed by combinatorial engineering.
Resolution2.296 Å
Binding residue
(original residue number in PDB)		L17 Y22 F23 F33 V34 Y35 G36 C38 G40 N41 R42 N43 C55
Binding residue
(residue number reindexed from 1)		L2 Y7 F8 F18 V19 Y20 G21 C23 G25 N26 R27 N28 C40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity

View graph for
Molecular Function
External links
PDB RCSB:5nx3, PDBe:5nx3, PDBj:5nx3
PDBsum5nx3
PubMed29934309
UniProtP05067|A4_HUMAN Amyloid-beta precursor protein (Gene Name=APP)

[Back to BioLiP]