Structure of PDB 5nj8 Chain D Binding Site BS01

Receptor Information
>5nj8 Chain D (length=134) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILR
MAVSHMKSLRGTSTDGSYKPSFLTDQELKHLILEAADFLFYVSDSVTPVQ
PQSESTLYDSRRSFICRMRCHCTGYIKALVAIGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nj8 Structural Basis for Aryl Hydrocarbon Receptor-Mediated Gene Activation.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		I97 E98 R101
Binding residue
(residue number reindexed from 1)		I14 E15 R18
Binding affinityPDBbind-CN: Kd=90nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0005667 transcription regulator complex
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nj8, PDBe:5nj8, PDBj:5nj8
PDBsum5nj8
PubMed28602820
UniProtP27540|ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator (Gene Name=ARNT)

[Back to BioLiP]