Structure of PDB 5nc7 Chain D Binding Site BS01

Receptor Information
>5nc7 Chain D (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGR
KIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFA
SAMMHALEVL
Ligand information
>5nc7 Chain L (length=10) Species: 1639 (Listeria monocytogenes) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WPPPPTEDEL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nc7 Designed nanomolar small-molecule inhibitors of Ena/VASP EVH1 interaction impair invasion and extravasation of breast cancer cells.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y16 K22 W23 K69 N71 F77 Q79 W80 R81 N90
Binding residue
(residue number reindexed from 1)		Y15 K21 W22 K68 N70 F76 Q78 W79 R80 N89
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5nc7, PDBe:5nc7, PDBj:5nc7
PDBsum5nc7
PubMed33184177
UniProtQ8N8S7|ENAH_HUMAN Protein enabled homolog (Gene Name=ENAH)

[Back to BioLiP]