Structure of PDB 5nbl Chain D Binding Site BS01

Receptor Information
>5nbl Chain D (length=366) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHGQKDSYVGDEA
QSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA
PMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDG
VTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREI
VRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAP
EALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPG
IAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWIS
KQEYDESGPSIVHHKC
Ligand information
>5nbl Chain H (length=20) Species: 7111 (Trichoplusia ni) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nbl The nuclear actin-containing Arp8 module is a linker DNA sensor driving INO80 chromatin remodeling.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		G146 T351
Binding residue
(residue number reindexed from 1)		G138 T343
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0005200 structural constituent of cytoskeleton
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0042802 identical protein binding
Biological Process
GO:0000011 vacuole inheritance
GO:0006281 DNA repair
GO:0006338 chromatin remodeling
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006897 endocytosis
GO:0009306 protein secretion
GO:0030010 establishment of cell polarity
GO:0030476 ascospore wall assembly
GO:1902404 mitotic actomyosin contractile ring contraction
Cellular Component
GO:0000142 cellular bud neck contractile ring
GO:0000785 chromatin
GO:0000812 Swr1 complex
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005884 actin filament
GO:0030479 actin cortical patch
GO:0031011 Ino80 complex
GO:0032432 actin filament bundle
GO:0035267 NuA4 histone acetyltransferase complex
GO:0043232 intracellular non-membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nbl, PDBe:5nbl, PDBj:5nbl
PDBsum5nbl
PubMed30177756
UniProtP60010|ACT_YEAST Actin (Gene Name=ACT1)

[Back to BioLiP]