Structure of PDB 5n99 Chain D Binding Site BS01

Receptor Information
>5n99 Chain D (length=122) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAP
ATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGT
TEANAWKSTLVGHDTFTKVKPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n99 Stepwise Evolution Improves Identification of Diverse Peptides Binding to a Protein Target.
Resolution1.5 Å
Binding residue
(original residue number in PDB)
L25 S45 W79 R84 S88 T90 W108
Binding residue
(residue number reindexed from 1)
L11 S31 W65 R70 S74 T76 W94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5n99, PDBe:5n99, PDBj:5n99
PDBsum5n99
PubMed28935886
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]