Structure of PDB 5n8j Chain D Binding Site BS01

Receptor Information

>5n8j Chain D (length=120) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAP
ATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGT
TEANAWKSTLVGHDTFTKVK

Ligand information

>5n8j Chain P (length=9) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GLANVDESS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5n8j Stepwise Evolution Improves Identification of Diverse Peptides Binding to a Protein Target.
Resolution	1.05 Å
Binding residue (original residue number in PDB)	L25 S27 E44 S45 A46 W79 R84 S88 T90 W108
Binding residue (residue number reindexed from 1)	L11 S13 E30 S31 A32 W65 R70 S74 T76 W94

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009374	biotin binding

View graph for
Molecular Function

External links

PDB	RCSB:5n8j, PDBe:5n8j, PDBj:5n8j
PDBsum	5n8j
PubMed	28935886
UniProt	P22629\|SAV_STRAV Streptavidin

[Back to BioLiP]