Structure of PDB 5n8e Chain D Binding Site BS01

Receptor Information

>5n8e Chain D (length=120) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPA
TDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTT
EANAWKSTLVGHDTFTKVKP

Ligand information

>5n8e Chain E (length=12) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RDPAPAWAHGGG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5n8e Stepwise Evolution Improves Identification of Diverse Peptides Binding to a Protein Target.
Resolution	1.1 Å
Binding residue (original residue number in PDB)	N23 L25 S27 Y43 E44 S45 S52 W79 S88 T90 W108 L110
Binding residue (residue number reindexed from 1)	N8 L10 S12 Y28 E29 S30 S37 W64 S73 T75 W93 L95

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009374	biotin binding

View graph for
Molecular Function

External links

PDB	RCSB:5n8e, PDBe:5n8e, PDBj:5n8e
PDBsum	5n8e
PubMed	28935886
UniProt	P22629\|SAV_STRAV Streptavidin

[Back to BioLiP]