Structure of PDB 5lxi Chain D Binding Site BS01

Receptor Information

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL
VPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHE
EDYFLYVAYSDESVYGK

Ligand information

EDEDFEILSL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

PDB	5lxi ATG4B contains a C-terminal LIR motif important for binding and efficient cleavage of mammalian orthologs of yeast Atg8.
Resolution	1.44 Å
Binding residue (original residue number in PDB)	Y5 H9 E17 I21 R28 K46 R47 K48 Y49 L50 P52 R67 F104
Binding residue (residue number reindexed from 1)	Y5 H9 E17 I21 R28 K46 R47 K48 Y49 L50 P52 R67 F104

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0005543	phospholipid binding
GO:0008429	phosphatidylethanolamine binding
GO:0030957	Tat protein binding
GO:0031625	ubiquitin protein ligase binding
GO:0048487	beta-tubulin binding
GO:0050811	GABA receptor binding

	Biological Process
GO:0000045	autophagosome assembly
GO:0000422	autophagy of mitochondrion
GO:0006914	autophagy
GO:0006995	cellular response to nitrogen starvation
GO:0061723	glycophagy
GO:0097352	autophagosome maturation

	Cellular Component
GO:0000421	autophagosome membrane
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005776	autophagosome
GO:0005783	endoplasmic reticulum
GO:0005794	Golgi apparatus
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005874	microtubule
GO:0016020	membrane
GO:0030659	cytoplasmic vesicle membrane
GO:0031410	cytoplasmic vesicle

External links

PDB	RCSB:5lxi, PDBe:5lxi, PDBj:5lxi
PDBsum	5lxi
PubMed	28287329
UniProt	Q9H0R8\|GBRL1_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 1 (Gene Name=GABARAPL1)