Structure of PDB 5lum Chain D Binding Site BS01

Receptor Information
>5lum Chain D (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRY
RLPPGVDPAAVTSALSPEGVLSIQAAPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lum Structural Basis for the Interaction of a Human Small Heat Shock Protein with the 14-3-3 Universal Signaling Regulator.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		K81 H82 F83 P138 E139
Binding residue
(residue number reindexed from 1)		K10 H11 F12 P67 E68
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5lum, PDBe:5lum, PDBj:5lum
PDBsum5lum
PubMed28089448
UniProtO14558|HSPB6_HUMAN Heat shock protein beta-6 (Gene Name=HSPB6)

[Back to BioLiP]