Structure of PDB 5l1z Chain D Binding Site BS01

Receptor Information
>5l1z Chain D (length=49) Species: 11678 (Human immunodeficiency virus type 1 BH10) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGR
Ligand information
>5l1z Chain N (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaucugagccugggagcucuc
.....<<<<......>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l1z Insights into HIV-1 proviral transcription from integrative structure and dynamics of the Tat:AFF4:P-TEFb:TAR complex.
Resolution5.9 Å
Binding residue
(original residue number in PDB)		N24 C25 Y26
Binding residue
(residue number reindexed from 1)		N24 C25 Y26
Binding affinityPDBbind-CN: Kd=0.20nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001070 RNA-binding transcription regulator activity
Biological Process
GO:0050434 positive regulation of viral transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5l1z, PDBe:5l1z, PDBj:5l1z
PDBsum5l1z
PubMed27731797
UniProtP69697|TAT_HV1B1 Protein Tat (Gene Name=tat)

[Back to BioLiP]