Structure of PDB 5l0y Chain D Binding Site BS01

Receptor Information
>5l0y Chain D (length=150) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANINKLRESGNAEYRKQRYGDAIKLYTLGLQMALTRPAWEPAGLVRDEIH
QLYSNRAQAYMQLGQWPEAAADAECSVEAKRQGNAKAWYRRGKCLMEMRR
LQEAREWVARGLEFEEEKELAELLKEIDSKLAAEKASRDAHDNPTVEEVD
Ligand information
>5l0y Chain L (length=6) Species: 209285 (Thermochaetoides thermophila) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TVEEVD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l0y Two alternative binding mechanisms connect the protein translocation Sec71-Sec72 complex with heat shock proteins.
Resolution2.87 Å
Binding residue
(original residue number in PDB)		N84 Y87 N128 K159 E193
Binding residue
(residue number reindexed from 1)		N11 Y14 N55 K86 E119
Enzymatic activity
Enzyme Commision number ?
External links