Structure of PDB 5kq1 Chain D Binding Site BS01

Receptor Information
>5kq1 Chain D (length=122) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSI
EGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTEN
QHVVGLWMFDPNDMSRIFNIVK
Ligand information
>5kq1 Chain C (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EPPSPSVLPKPPSHWVPVSFNP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kq1 Structural basis of mRNA-cap recognition by Dcp1-Dcp2.
Resolution3.002 Å
Binding residue
(original residue number in PDB)
Q37 N76 L77 H102
Binding residue
(residue number reindexed from 1)
Q37 N76 L77 H102
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0170008 mRNA phosphatase activator activity
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006397 mRNA processing
GO:0043085 positive regulation of catalytic activity
GO:0110156 mRNA methylguanosine-cap decapping
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0010494 cytoplasmic stress granule
GO:0098745 RNA decapping complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5kq1, PDBe:5kq1, PDBj:5kq1
PDBsum5kq1
PubMed27694842
UniProtQ9P805|DCP1_SCHPO mRNA-decapping enzyme subunit 1 (Gene Name=dcp1)

[Back to BioLiP]