Structure of PDB 5kkq Chain D Binding Site BS01

Receptor Information
>5kkq Chain D (length=145) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHI
RSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kkq Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution1.744 Å
Binding residue
(original residue number in PDB)
F351 Y392 Y407 S419 K423 K449 S450
Binding residue
(residue number reindexed from 1)
F31 Y72 Y87 S99 K103 K129 S130
Binding affinityPDBbind-CN: Kd=9nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5kkq, PDBe:5kkq, PDBj:5kkq
PDBsum5kkq
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]