Structure of PDB 5k18 Chain D Binding Site BS01

Receptor Information

>5k18 Chain D (length=177) Species: 294748 (Candida albicans WO-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TSIKPFQMEDLFELNPVNLDPLTENFNVSFYSQYLIEWPQLFYKSVETPN
GQASGYMMAKTEGQLSKKEWHTHITAVTVLDQYRRIGLASKLCLELENLT
QVKDTLFIDLFVKVTNTLGRILYEKLGYSVFRRVVGYYGREIKDRNKIDD
SVDAFDMRKLLPENGEKVYVLPNEIVF

Ligand information

>5k18 Chain F (length=6) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MDSEVA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5k18 Molecular Basis of Substrate Specific Acetylation by N-Terminal Acetyltransferase NatB
Resolution	2.73 Å
Binding residue (original residue number in PDB)	L23 E25 F27 H74 T76 A77 F112 Y138 Y139
Binding residue (residue number reindexed from 1)	L22 E24 F26 H73 T75 A76 F111 Y137 Y138

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004596	peptide alpha-N-acetyltransferase activity
GO:0016740	transferase activity
GO:0016747	acyltransferase activity, transferring groups other than amino-acyl groups

	Biological Process
GO:0017196	N-terminal peptidyl-methionine acetylation

	Cellular Component
GO:0031416	NatB complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5k18, PDBe:5k18, PDBj:5k18
PDBsum	5k18
PubMed	28380339
UniProt	C4YDZ9

[Back to BioLiP]