Structure of PDB 5jtp Chain D Binding Site BS01

Receptor Information

>5jtp Chain D (length=155) Species: 83334 (Escherichia coli O157:H7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQ
LADDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGA
YCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTE
EHQDA

Ligand information

>5jtp Chain H (length=22) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NVVGLTDQTDLFYTMKAALGLK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5jtp Structural basis for the antifolding activity of a molecular chaperone.
Resolution	N/A
Binding residue (original residue number in PDB)	Q4 W36 Q37 P38 V40 K41 L42 L44 D54 Y56 E90 G91 M94 A95 L126 V131 F133 L136 F137 Y140
Binding residue (residue number reindexed from 1)	Q4 W36 Q37 P38 V40 K41 L42 L44 D54 Y56 E90 G91 M94 A95 L126 V131 F133 L136 F137 Y140

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0051082	unfolded protein binding
GO:0070678	preprotein binding

	Biological Process
GO:0006457	protein folding
GO:0006605	protein targeting
GO:0008104	protein localization
GO:0015031	protein transport
GO:0036506	maintenance of unfolded protein
GO:0043952	protein transport by the Sec complex
GO:0051262	protein tetramerization

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5jtp, PDBe:5jtp, PDBj:5jtp
PDBsum	5jtp
PubMed	27501151
UniProt	P0AG86\|SECB_ECOLI Protein-export protein SecB (Gene Name=secB)

[Back to BioLiP]