Structure of PDB 5jlw Chain D Binding Site BS01

Receptor Information

>5jlw Chain D (length=57) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRR
MKWKKEN

Ligand information

>5jlw Chain E (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agaaagccattagag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5jlw Stereospecific Effects of Oxygen-to-Sulfur Substitution in DNA Phosphate on Ion Pair Dynamics and Protein-DNA Affinity.
Resolution	2.088 Å
Binding residue (original residue number in PDB)	R5 Y25 R31 Q50 R53 M54
Binding residue (residue number reindexed from 1)	R2 Y22 R28 Q47 R50 M51
Binding affinity	PDBbind-CN: Kd=3nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5jlw, PDBe:5jlw, PDBj:5jlw
PDBsum	5jlw
PubMed	27271797
UniProt	P02833\|ANTP_DROME Homeotic protein antennapedia (Gene Name=Antp)

[Back to BioLiP]