Structure of PDB 5jge Chain D Binding Site BS01

Receptor Information
>5jge Chain D (length=30) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHMLDNFMKQLLKLEESLNKLELEQKVTN
Ligand information
>5jge Chain F (length=23) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GPMEEQREILEQLKKTLQMLTVY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jge Structural Basis for Receptor-Mediated Selective Autophagy of Aminopeptidase I Aggregates
Resolution1.91 Å
Binding residue
(original residue number in PDB)		H158 L160 M164 L167 E171 L174 L177 E178 Q181
Binding residue
(residue number reindexed from 1)		H3 L5 M9 L12 E16 L19 L22 E23 Q26
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5jge, PDBe:5jge, PDBj:5jge
PDBsum5jge
PubMed27320913
UniProtP35193|ATG19_YEAST Autophagy-related protein 19 (Gene Name=ATG19)

[Back to BioLiP]