Structure of PDB 5isz Chain D Binding Site BS01

Receptor Information
>5isz Chain D (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMT
LNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAFDTNAGKSTF
GDGTTLTVKPNIQNPDPAVYQLRDSASSAKSVCLFTDFDSQTNVSQSKDD
VYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5isz Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8(+) T cell epitope.
Resolution2.06 Å
Binding residue
(original residue number in PDB)		N95 A96
Binding residue
(residue number reindexed from 1)		N94 A95
External links