Structure of PDB 5i44 Chain D Binding Site BS01

Receptor Information
>5i44 Chain D (length=67) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMNTNMVASELGVSAKTVQRWVKQLNLPAERNELGHYSFTAEDVKVLK
SVKKQISEGTAIQDIHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5i44 Molecular insights into DNA binding and anchoring by the Bacillus subtilis sporulation kinetochore-like RacA protein.
Resolution2.621 Å
Binding residue
(original residue number in PDB)
S17 R23
Binding residue
(residue number reindexed from 1)
S16 R22
Binding affinityPDBbind-CN: Kd=9.2uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5i44, PDBe:5i44, PDBj:5i44
PDBsum5i44
PubMed27085804
UniProtP45870|RACA_BACSU Chromosome-anchoring protein RacA (Gene Name=racA)

[Back to BioLiP]