Structure of PDB 5hod Chain D Binding Site BS01

Receptor Information
>5hod Chain D (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNR
RAKEKRLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hod Impact of cytosine methylation on DNA binding specificities of human transcription factors.
Resolution2.682 Å
Binding residue
(original residue number in PDB)		R89 T90 I92 R127 V131 W132 N135
Binding residue
(residue number reindexed from 1)		R3 T4 I6 R41 V45 W46 N49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5hod, PDBe:5hod, PDBj:5hod
PDBsum5hod
PubMed28473536
UniProtQ969G2|LHX4_HUMAN LIM/homeobox protein Lhx4 (Gene Name=LHX4)

[Back to BioLiP]