Structure of PDB 5hlg Chain D Binding Site BS01

Receptor Information
>5hlg Chain D (length=139) Species: 1282 (Staphylococcus epidermidis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CNMKQEQMRLANQLCFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLW
EENPQTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITL
TDNGQQQQEAVFEAISSCLPQDETKYVFEELEQTLKHLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hlg Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		T37 S39 N67 T68 M72 R75 D90 K91 R92
Binding residue
(residue number reindexed from 1)		T39 S41 N69 T70 M74 R77 D92 K93 R94
Binding affinityPDBbind-CN: Kd=0.31uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5hlg, PDBe:5hlg, PDBj:5hlg
PDBsum5hlg
PubMed28086264
UniProtQ5HKZ1

[Back to BioLiP]