Structure of PDB 5h58 Chain D Binding Site BS01

Receptor Information

>5h58 Chain D (length=193) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EQTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKEDLA
HAILEIQSRTSRRLAKDLDYSSLEALMRLTFGMARLCVQGPVLRAGLRLA
TAGVPVRLPHPFTEWREIATSRLLDAVRQSDVHQDIDVDSVAHTLVCSVV
GTRVAGREPRRLAEMWYILIRGMVPVTRRARYVTLAARLEQET

Ligand information

>5h58 Chain E (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aggcggcacggtctgttgag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5h58 Structural and dynamics studies of the TetR family protein, CprB from Streptomyces coelicolor in complex with its biological operator sequence
Resolution	3.991 Å
Binding residue (original residue number in PDB)	T31 L32 S33 K43 Y47 A52 K53
Binding residue (residue number reindexed from 1)	T24 L25 S26 K36 Y40 A45 K46

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5h58, PDBe:5h58, PDBj:5h58
PDBsum	5h58
PubMed	28343010
UniProt	Q7AKF2

[Back to BioLiP]