Structure of PDB 5gwt Chain D Binding Site BS01

Receptor Information

>5gwt Chain D (length=243) Species: 1428 (Bacillus thuringiensis)

KIIMISGANSGIGHACIKYFLEKSFHVIALDINNNNLIDYMKTDMPLKVV
QIDLSNSEAIHNLFTQLDLEKLSPDILINAAGIREITPVLHLSDDMFKKV
IDVNLVAPFILSREVAKRWCESKIKGCIVNIASVSGLMAKPERAAYVASK
HALIGLTKQMAMEFGKQNIRVNSISPGVIRTELTEEYFSNKALMSMIKSN
QSLDTWGLPQDIVSCIEYLISDQARFITGSNFVIDGGQTAGKN

Ligand information

• Ligand ID: NAD
• InChI: InChI=1S/C21H27N7O14P2/c22-17-12-19(25-7-24-17)28(8-26-12)21-16(32)14(30)11(41-21)6-39-44(36,37)42-43(34,35)38-5-10-13(29)15(31)20(40-10)27-3-1-2-9(4-27)18(23)33/h1-4,7-8,10-11,13-16,20-21,29-32H,5-6H2,(H5-,22,23,24,25,33,34,35,36,37)/t10-,11-,13-,14-,15-,16-,20-,21-/m1/s1
• InChIKey: BAWFJGJZGIEFAR-NNYOXOHSSA-N
• SMILES:
  CACTVS 3.341: NC(=O)c1ccc[n+](c1)[C@@H]2O[C@H](CO[P]([O-])(=O)O[P@](O)(=O)OC[C@H]3O[C@H]([C@H](O)[C@@H]3O)n4cnc5c(N)ncnc45)[C@@H](O)[C@H]2O
  OpenEye OEToolkits 1.5.0: c1cc(c[n+](c1)C2C(C(C(O2)COP(=O)([O-])OP(=O)(O)OCC3C(C(C(O3)n4cnc5c4ncnc5N)O)O)O)O)C(=O)N
  CACTVS 3.341: NC(=O)c1ccc[n+](c1)[CH]2O[CH](CO[P]([O-])(=O)O[P](O)(=O)OC[CH]3O[CH]([CH](O)[CH]3O)n4cnc5c(N)ncnc45)[CH](O)[CH]2O
  OpenEye OEToolkits 1.5.0: c1cc(c[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2)CO[P@@](=O)([O-])O[P@@](=O)(O)OC[C@@H]3[C@H]([C@H]([C@@H](O3)n4cnc5c4ncnc5N)O)O)O)O)C(=O)N
• Formula: C21 H27 N7 O14 P2
• Name: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
• ChEMBL: CHEMBL1234613
• DrugBank: DB14128
• PDB chain: 5gwt Chain D Residue 302

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5gwt Engineering a short-chain dehydrogenase/reductase for the stereoselective production of (2S,3R,4S)-4-hydroxyisoleucine with three asymmetric centers.
• Resolution: 1.9 Å
• Binding residue (original residue number in PDB): G11 S14 G15 D35 I36 I56 D57 L58 A84 G86 I87 S137 Y150 K154 P180 G181 I183 T185 L187 T188
• Binding residue (residue number reindexed from 1): G7 S10 G11 D31 I32 I52 D53 L54 A80 G82 I83 S133 Y146 K150 P176 G177 I179 T181 L183 T184
• Annotation score: 4

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 08:25:59 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5gwt', asym_id = 'D', bs = 'BS01', title = 'Engineering a short-chain dehydrogenase/reductas...hydroxyisoleucine with three asymmetric centers. '

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5gwt', asym_id='D', bs='BS01', title='Engineering a short-chain dehydrogenase/reductas...hydroxyisoleucine with three asymmetric centers. ')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '5gwt', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='5gwt', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>