Structure of PDB 5gpc Chain D Binding Site BS01

Receptor Information

>5gpc Chain D (length=190) Species: 272558 (Halalkalibacterium halodurans C-125) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KGPKYDQIIDAAVQVIAEHGYHQAQVSKIAKAAGVADGTIYLYFNNKEDV
LISLFQEKMGRFVDKIRSQMNEATDVEEKLKILVNMHFKQLAADHKLAIV
TQLELRQSNTELRLKINEVLKGYLNLLDELLMEGKEKGYFFQELDTRLAR
QMIFGTLDEVVTNWVMKDCKYDLTALVKPVHQLLLGGLRH

Ligand information

>5gpc Chain G (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

catgaatgagtattcattcat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5gpc Structural basis of operator sites recognition and effector binding in the TetR family transcription regulator FadR.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	Q29 V30 Y45 N50 K51
Binding residue (residue number reindexed from 1)	Q25 V26 Y41 N46 K47
Binding affinity	PDBbind-CN: Kd~100nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5gpc, PDBe:5gpc, PDBj:5gpc
PDBsum	5gpc
PubMed	28160603
UniProt	Q9K8A4

[Back to BioLiP]