Structure of PDB 5gap Chain D Binding Site BS01

Receptor Information
>5gap Chain D (length=140) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASVLLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAE
RVRNFAVIYLCDIDEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNN
KLNFIVDDKQEMIDILETIFRGARKNKGLVVSPYDYNHKR
Ligand information
>5gap Chain W (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auuuggucaauuugaauacagagaucagcaguuccccugcauaaggauga
accguu
.........<<<..>>>.................................
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gap Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		G96 G98 N100 K126 N127 K128 G129 N138 R141
Binding residue
(residue number reindexed from 1)		G95 G97 N99 K125 N126 K127 G128 N137 R140
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0046540 U4/U6 x U5 tri-snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gap, PDBe:5gap, PDBj:5gap
PDBsum5gap
PubMed26829225
UniProtQ06819|DIB1_YEAST Spliceosomal protein DIB1 (Gene Name=DIB1)

[Back to BioLiP]